Product Added to your Cart
x

-------- OR --------

$0.00
Currency
AEDAFNALLAMDANGAOAARSAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
  • Kase Annealr MKII

    Kase Annealr MKII

  • Kase Annealr MKII (accessories not included)

    Kase Annealr MKII (accessories not included)

  • Kase Annealr MKII - Annealing 308 Brass

    Kase Annealr MKII - Annealing 308 Brass

  • Kase Annealr MKII - Annealing 308 Brass

    Kase Annealr MKII - Annealing 308 Brass

  • Kase Annealr MKII - Annealing 308 Brass

    Kase Annealr MKII - Annealing 308 Brass

  • Kase AnnealR MKII - Parts

    Kase AnnealR MKII - Parts

Featured Products

Status Update 01/05/24

Sorry all machines sold out!
We are just supporting our customers with parts as they need them.





 

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i